PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA11957
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 291aa    MW: 32412.8 Da    PI: 7.2726
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA11957genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-3939100263
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                +e+al+cprC+stntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Tp57577_TGAC_v2_mRNA11957  39 PEHALNCPRCNSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 100
                                68899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-264197IPR003851Zinc finger, Dof-type
PfamPF027011.6E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4784397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDIMDPSCGQ TQQMSSQSSM ENMLGCSKEE QERKPKPQPE HALNCPRCNS TNTKFCYYNN  60
YSLTQPRYFC KSCRRYWTKG GTLRNVPVGG GCRKNKRSSS SSSSKRVQEQ NQTFTPNLNP  120
FNNLPLSSYD HNSNDFALAF ARLQKQSCGG QMGYDDNDLS ILGNPQNHGF MDAIRSGLFL  180
GNGLHYNNNV QNMYGGYGNG GDNGEVNSCN NNNNNACGVS EEMMFPYDQE MNNCIATTNM  240
KQEQSESKVF GGFPWQLNGG TNMVELESTR ASWNNGFTSP WQGLLHSPLM *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1384111e-144BT138411.1 Medicago truncatula clone JCVI-FLMt-14J10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597150.11e-157Dof domain zinc finger protein
SwissprotQ8LE434e-52DOF21_ARATH; Dof zinc finger protein DOF2.1
TrEMBLG7IU511e-157G7IU51_MEDTR; Dof domain zinc finger protein
STRINGGLYMA12G07710.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.12e-40Dof family protein